PDB entry 1ril

View 1ril on RCSB PDB site
Description: crystal structure of ribonuclease h from thermus thermophilus hb8 refined at 2.8 angstroms resolution
Deposited on 1993-01-14, released 1993-10-31
The last revision prior to the SCOP 1.63 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1ril__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ril_ (-)
    rkrvalftdgaclgnpgpggwaallrfhahekllsggeacttnnrmelkaaieglkalke
    pcevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhf
    vkghtghpenervdrearrqaqsqakt