PDB entry 1rih

View 1rih on RCSB PDB site
Description: Crystal Structure of Fab 14F7, a unique anti-tumor antibody specific for N-glycolyl GM3
Class: immune system
Keywords: Antibody, carbohydrate-binding Fab, specific for NeuGc-GM3, immunoglobulin, beta-sheet topology
Deposited on 2003-11-17, released 2004-01-13
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain of antibody 14F7
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAH31498 (125-End)
    Domains in SCOP 1.75: d1rihh1, d1rihh2
  • Chain 'L':
    Compound: light chain of antibody 14F7
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAQ83524 (109-End)
      • conflict (75)
    Domains in SCOP 1.75: d1rihl1, d1rihl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rihH (H:)
    qvqlqqsgnelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rihH (H:)
    qvqlqqsgnelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rihL (L:)
    dlvltqspatlsvtpgdsvsfscrasqsisnnlhwyqqrthesprllikyasqsisgips
    rfsgsgsgtdftlsissvetedfgmyfcqqsnrwpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rihL (L:)
    dlvltqspatlsvtpgdsvsfscrasqsisnnlhwyqqrthesprllikyasqsisgips
    rfsgsgsgtdftlsissvetedfgmyfcqqsnrwpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn