PDB entry 1rih

View 1rih on RCSB PDB site
Description: crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Deposited on 2003-11-17, released 2004-01-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rihH (H:)
    qvqlqqsgnelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgckp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rihH (H:)
    qvqlqqsgnelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rihL (L:)
    dlvltqspatlsvtpgdsvsfscrasqsisnnlhwyqqrthesprllikyasqsisgips
    rfsgsgsgtdftlsissvetedfgmyfcqqsnrwpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rihL (L:)
    dlvltqspatlsvtpgdsvsfscrasqsisnnlhwyqqrthesprllikyasqsisgips
    rfsgsgsgtdftlsissvetedfgmyfcqqsnrwpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn