PDB entry 1rie

View 1rie on RCSB PDB site
Description: structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex
Deposited on 1996-02-23, released 1996-12-07
The last revision prior to the SCOP 1.63 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.187
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1rie__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rie_ (-)
    amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
    pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
    ddmvivg