PDB entry 1ri9

View 1ri9 on RCSB PDB site
Description: Structure of a helically extended SH3 domain of the T cell adapter protein ADAP
Class: signaling protein
Keywords: sh3-like, helically extended, signaling protein
Deposited on 2003-11-17, released 2004-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FYN-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FYB, SLAP130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ri9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ri9A (A:)
    mgsshhhhhhssgkklkkqekeekdfrkkfkydgeirvlystkvttsitskkwgtrdlqv
    kpgesleviqttddtkvlcrneegkygyvlrsyladndgeiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ri9A (A:)
    ekeekdfrkkfkydgeirvlystkvttsitskkwgtrdlqvkpgesleviqttddtkvlc
    rneegkygyvlrsylad