PDB entry 1ri0

View 1ri0 on RCSB PDB site
Description: NMR structure of the N-terminal hath domain of human HDGF
Class: hormone/growth factor
Keywords: HDGF, hath domain, PWWP domain, heparin-binding, growth factor, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-11-16, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatoma-derived growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: Hdgf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ri0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ri0A (A:)
    mhhhhhhamamsrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfff
    gthetaflgpkdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ri0A (A:)
    msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
    kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy