PDB entry 1rhz

View 1rhz on RCSB PDB site
Description: The structure of a protein conducting channel
Class: protein transport
Keywords: Protein translocation, SecY, Membrane Protein, Protein Channels, protein transport
Deposited on 2003-11-15, released 2004-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.254
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase secY subunit
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: SECY, MJ0478
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rhza_
  • Chain 'B':
    Compound: Preprotein translocase secE subunit
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: SECE, MJ0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rhzb_
  • Chain 'C':
    Compound: SecBeta
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RHZ
    Domains in SCOPe 2.07: d1rhzc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rhzA (A:)
    mkklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwq
    titasrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcf
    veavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsq
    tifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgri
    kgavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayyl
    stpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfr
    ksekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllr
    ekvselhpaiakllnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhzA (A:)
    kklipilekipevelpvkeitfkeklkwtgivlvlyfimgcidvytagaqipaifefwqt
    itasrigtlitlgigpivtagiimqllvgsgiiqmdlsipenralfqgcqkllsiimcfv
    eavlfvgagafgiltpllaflviiqiafgsiiliyldeivskygigsgiglfiaagvsqt
    ifvgalgpegylwkflnsliqgvpnieyiapiigtiivflmvvyaecmrveiplahgrik
    gavgkypikfvyvsnipvilaaalfaniqlwglalyrmgipilghyeggravdgiayyls
    tpyglssvisdpihaivymiamiitcvmfgifwvettgldpksmakrigslgmaikgfrk
    sekaiehrlkryippltvmssafvgflatianfigalgggtgvlltvsivyrmyeqllre
    kvselhpaiakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rhzB (B:)
    mktdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpat
    yikgilkppttprv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhzB (B:)
    tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
    kgilk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rhzC (C:)
    mskreetglatsaglirymdetfskirvkpehvigvtvafviieailtygrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhzC (C:)
    etfskirvkpehvigvtvafviieailtygrf