PDB entry 1rhy

View 1rhy on RCSB PDB site
Description: Crystal structure of Imidazole Glycerol Phosphate Dehydratase
Class: lyase
Keywords: dehydratases; histidine biosynthesis; left-handed b-a-b crossover motif; gene duplication
Deposited on 2003-11-14, released 2004-05-04
The last revision prior to the SCOP 1.75 freeze date was dated 2004-05-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazole glycerol phosphate dehydratase
    Species: Cryptococcus neoformans
    Gene: His3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rhya1, d1rhya2
  • Chain 'B':
    Compound: Imidazole glycerol phosphate dehydratase
    Species: Cryptococcus neoformans
    Gene: His3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rhyb1, d1rhyb2
  • Heterogens: HG, EMC, SO4, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rhyA (A:)
    mseriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslql
    qckgdlhiddhhtaedcalalgeafkkalgerkgikrygyayapldeslsravidissrp
    yfmchlpftrekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalala
    irmaisrtggddvpstkgvlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhyA (A:)
    seriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslqlq
    ckgdltaedcalalgeafkkalgerkgikrygyayapldeslsravidissrpyfmchlp
    ftrekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalalairmaisr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rhyB (B:)
    mseriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslql
    qckgdlhiddhhtaedcalalgeafkkalgerkgikrygyayapldeslsravidissrp
    yfmchlpftrekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalala
    irmaisrtggddvpstkgvlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhyB (B:)
    seriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslqlq
    ckgdtaedcalalgeafkkalgerkgikrygyayapldeslsravidissrpyfmchlpf
    trekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalalairmaisrt