PDB entry 1rhy

View 1rhy on RCSB PDB site
Description: crystal structure of imidazole glycerol phosphate dehydratase
Deposited on 2003-11-14, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rhyA (A:)
    mseriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslql
    qckgdlhiddhhtaedcalalgeafkkalgerkgikrygyayapldeslsravidissrp
    yfmchlpftrekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalala
    irmaisrtggddvpstkgvlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhyA (A:)
    seriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslqlq
    ckgdltaedcalalgeafkkalgerkgikrygyayapldeslsravidissrpyfmchlp
    ftrekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalalairmaisr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rhyB (B:)
    mseriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslql
    qckgdlhiddhhtaedcalalgeafkkalgerkgikrygyayapldeslsravidissrp
    yfmchlpftrekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalala
    irmaisrtggddvpstkgvlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhyB (B:)
    seriasverttsethisctidldhipgvteqkinvstgigfldhmftalakhggmslqlq
    ckgdtaedcalalgeafkkalgerkgikrygyayapldeslsravidissrpyfmchlpf
    trekvgdlstemvshllqsfafaagvtlhidsirgennhhiaesafkalalairmaisrt