PDB entry 1rhx

View 1rhx on RCSB PDB site
Description: High-Resolution NMR Structure of the DsrH family protein involved in oxidation of intracellular sulfur (TM0979) from Thermotoga maritima
Class: structural genomics, unknown function
Keywords: TM0979, JCSG, NMR, structure determination, DsrH, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2003-11-14, released 2004-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-12, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TM0979
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rhxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rhxA (A:)
malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
seedskvplitysefidllegeekfig