PDB entry 1rhx

View 1rhx on RCSB PDB site
Description: high-resolution nmr structure of a putative sulfur transferase (tm0979) from thermotoga maritima
Class: transferase
Keywords: dsrh, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, transferase
Deposited on 2003-11-14, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein TM0979
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9X074 (0-86)
  Domains in SCOPe 2.08: d1rhxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rhxA (A:)
  malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargy
  seedskvplitysefidllegeekfig