PDB entry 1rhw

View 1rhw on RCSB PDB site
Description: The solution structure of the pH-induced monomer of dynein light chain LC8 from Drosophila
Class: contractile protein
Keywords: Domain swapped, Dimer interface, CONTRACTILE PROTEIN
Deposited on 2003-11-14, released 2004-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rhwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rhwA (A:)
    msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
    nfgsyvthetrhfiyfylgqvaillfksg