PDB entry 1rhw

View 1rhw on RCSB PDB site
Description: the solution structure of the ph-induced monomer of dynein light chain lc8 from drosophila
Deposited on 2003-11-14, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1rhwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rhwA (A:)
  msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
  nfgsyvthetrhfiyfylgqvaillfksg