PDB entry 1rhs

View 1rhs on RCSB PDB site
Description: sulfur-substituted rhodanese
Deposited on 1997-07-16, released 1998-01-21
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-21, with a file datestamp of 1998-01-21.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.1694
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rhs_ (-)
    vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
    eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
    rtvsvlnggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvd
    sraqgrylgtqpepdavgldsghirgsvnmpfmnfltedgfekspeelramfeakkvdlt
    kpliatcrkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkg