PDB entry 1rhh

View 1rhh on RCSB PDB site
Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution
Deposited on 2003-11-14, released 2004-02-24
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rhhA (A:)
    elvltqspgtlslsageratlscrasqsvssgslawyqqkpgqaprlliygastratgip
    drfsgsgsgtdftltigrlepedlavyycqqygtspytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsrdstyslgstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rhhB (B:)
    evqlleqsgaevkkpgssvqvsckasggtfsmygfnwvrqapghglewmggiipifgtsn
    yaqkfrgrvtftadqatstaymeltnlrsddtavyycardfgpdwedgdsydgsgrgffd
    fwgqgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhhB (B:)
    qlleqsgaevkkpgssvqvsckasggtfsmygfnwvrqapghglewmggiipifgtsnya
    qkfrgrvtftadqatstaymeltnlrsddtavyycardfgpdwedgdsydgsgrgffdfw
    gqgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rhhC (C:)
    elvltqspgtlslsageratlscrasqsvssgslawyqqkpgqaprlliygastratgip
    drfsgsgsgtdftltigrlepedlavyycqqygtspytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsrdstyslgstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rhhD (D:)
    evqlleqsgaevkkpgssvqvsckasggtfsmygfnwvrqapghglewmggiipifgtsn
    yaqkfrgrvtftadqatstaymeltnlrsddtavyycardfgpdwedgdsydgsgrgffd
    fwgqgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rhhD (D:)
    lleqsgaevkkpgssvqvsckasggtfsmygfnwvrqapghglewmggiipifgtsnyaq
    kfrgrvtftadqatstaymeltnlrsddtavyycardfgpdwedgdsydgsgrgffdfwg
    qgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc