PDB entry 1rhd

View 1rhd on RCSB PDB site
Description: structure of bovine liver rhodanese. I. structure determination at 2.5 angstroms resolution and a comparison of the conformation and sequence of its two domains
Class: transferase(thiosulfate,cyanide sulfur)
Keywords: transferase(thiosulfate, cyanide sulfur)
Deposited on 1977-11-23, released 1978-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhodanese
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00586 (0-292)
      • conflict (98)
      • conflict (213)
      • conflict (218)
    Domains in SCOPe 2.07: d1rhda1, d1rhda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rhdA (A:)
    vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
    eecrdkaspyevmlpseagfadyvgslgisndthvvvyngddlgsfyaprvwwmfrvfgh
    rtvsvlnggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvd
    sraqgrylgtqpepdavgldsghirgsvnmpfmdfltengfekspeelramfeakkvdlt
    kpliatcrkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkg