PDB entry 1rhd

View 1rhd on RCSB PDB site
Description: structure of bovine liver rhodanese. i. structure determination at 2.5 angstroms resolution and a comparison of the conformation and sequence of its two domains
Deposited on 1977-11-23, released 1978-01-16
The last revision prior to the SCOP 1.57 freeze date was dated 1984-01-27, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rhd_ (-)
    vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
    eecrdkaspyevmlpseagfadyvgslgisndthvvvyngddlgsfyaprvwwmfrvfgh
    rtvsvlnggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvd
    sraqgrylgtqpepdavgldsghirgsvnmpfmdfltengfekspeelramfeakkvdlt
    kpliatcrkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkg