PDB entry 1rh9

View 1rh9 on RCSB PDB site
Description: Family GH5 endo-beta-mannanase from Lycopersicon esculentum (tomato)
Class: hydrolase
Keywords: ENDO-BETA-MANNASE, Retaining, Glycoside Hydrolase Family 5, mannan
Deposited on 2003-11-14, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-mannanase
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: LeMAN4a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rh9a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rh9A (A:)
    fsnnnfvytdgthfalngkslyingfnaywlmyiaydpstrikvtntfqqaskykmnvar
    twafshggsrplqsapgvyneqmfqgldfviseakkygihlimslvnnwdafggkkqyve
    wavqrgqkltsdddfftnpmvkgfyknnvkvvltrvntitkvaykddptilswelinepr
    cpsdlsgktfqnwvlemagylksidsnhlleiglegfygndmrqynpnsyifgtnfisnn
    qvqgidfttihmypnqwlpgltqeaqdkwasqwiqvhiddskmlkkplliaefgkstktp
    gytvakrdnyfekiygtifncaksggpcggglfwqvlgqgmssfddgyqvvlqespstsr
    villqslrlskls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh9A (A:)
    nnfvytdgthfalngkslyingfnaywlmyiaydpstrikvtntfqqaskykmnvartwa
    fshggsrplqsapgvyneqmfqgldfviseakkygihlimslvnnwdafggkkqyvewav
    qrgqkltsdddfftnpmvkgfyknnvkvvltrvntitkvaykddptilswelineprcps
    dlsgktfqnwvlemagylksidsnhlleiglegfygndmrqynpnsyifgtnfisnnqvq
    gidfttihmypnqwlpgltqeaqdkwasqwiqvhiddskmlkkplliaefgkstktpgyt
    vakrdnyfekiygtifncaksggpcggglfwqvlgqgmssfddgyqvvlqespstsrvil
    lqslrlskls