PDB entry 1rh8

View 1rh8 on RCSB PDB site
Description: Three-dimensional structure of the calcium-free Piccolo C2A-domain
Class: metal binding protein
Keywords: beta-sandwich
Deposited on 2003-11-14, released 2004-01-13
The last revision prior to the SCOP 1.73 freeze date was dated 2004-01-13, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Piccolo protein
    Species: Rattus norvegicus
    Gene: PCLO
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rh8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh8A (A:)
    ashpitgeiqlqinydlgnliihilqarnlvprdnngysdpfvkvyllpgrgqvmvvqna
    saeykrrtkyvqkslnpewnqtviyksismeqlmkktlevtvwdydrfssndflgevlid
    lsstshldntprwyplkeqtes