PDB entry 1rh8

View 1rh8 on RCSB PDB site
Description: three-dimensional structure of the calcium-free piccolo c2a-domain
Deposited on 2003-11-14, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rh8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rh8A (A:)
ashpitgeiqlqinydlgnliihilqarnlvprdnngysdpfvkvyllpgrgqvmvvqna
saeykrrtkyvqkslnpewnqtviyksismeqlmkktlevtvwdydrfssndflgevlid
lsstshldntprwyplkeqtes