PDB entry 1rh7

View 1rh7 on RCSB PDB site
Description: Crystal Structure of Resistin-like beta
Class: hormone/growth factor
Keywords: HORMONE; GLUCOSE UPTAKE; RESISTIN/FIZZ FAMILY, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2003-11-13, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Resistin-like beta
    Species: Mus musculus [TaxId:10090]
    Gene: RETNLB or FIZZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rh7a_
  • Chain 'B':
    Compound: Resistin-like beta
    Species: Mus musculus [TaxId:10090]
    Gene: RETNLB or FIZZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rh7b_
  • Chain 'C':
    Compound: Resistin-like beta
    Species: Mus musculus [TaxId:10090]
    Gene: RETNLB or FIZZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rh7c_
  • Chain 'D':
    Compound: Resistin-like beta
    Species: Mus musculus [TaxId:10090]
    Gene: RETNLB or FIZZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rh7d_
  • Chain 'E':
    Compound: Resistin-like beta
    Species: Mus musculus [TaxId:10090]
    Gene: RETNLB or FIZZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rh7e_
  • Chain 'F':
    Compound: Resistin-like beta
    Species: Mus musculus [TaxId:10090]
    Gene: RETNLB or FIZZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rh7f_
  • Heterogens: PT, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh7A (A:)
    csfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtgcacgygcgswdirng
    ntchcqcsvmdwasarccrma
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh7B (B:)
    csfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtgcacgygcgswdirng
    ntchcqcsvmdwasarccrma
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh7C (C:)
    csfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtgcacgygcgswdirng
    ntchcqcsvmdwasarccrma
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh7D (D:)
    csfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtgcacgygcgswdirng
    ntchcqcsvmdwasarccrma
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh7E (E:)
    csfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtgcacgygcgswdirng
    ntchcqcsvmdwasarccrma
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh7F (F:)
    csfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtgcacgygcgswdirng
    ntchcqcsvmdwasarccrma