PDB entry 1rh6
View 1rh6 on RCSB PDB site
Description: Bacteriophage Lambda Excisionase (Xis)-DNA Complex
Class: DNA binding protein/DNA
Keywords: Protein-DNA complex, DNA architectural protein, 'winged'-helix protein, phage excision, site-specific DNA recombination
Deposited on
2003-11-13, released
2004-06-29
The last revision prior to the SCOP 1.73 freeze date was dated
2004-06-29, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Excisionase
Species: Bacteriophage lambda
Gene: Xis
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1rh6a_ - Chain 'B':
Compound: Excisionase
Species: Bacteriophage lambda
Gene: Xis
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1rh6b_ - Chain 'C':
Compound: 5'-d(*cp*tp*ap*tp*gp*tp*ap*gp*tp*cp*tp*gp*tp*tp*g)-3'
- Chain 'D':
Compound: 5'-d(p*cp*ap*ap*cp*ap*gp*ap*cp*tp*ap*cp*ap*tp*ap*g)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1rh6A (A:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1rh6B (B:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
Sequence, based on observed residues (ATOM records): (download)
>1rh6B (B:)
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.