PDB entry 1rgx

View 1rgx on RCSB PDB site
Description: crystal structure of resisitin
Deposited on 2003-11-13, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rgxa_
  • Chain 'B':
    Domains in SCOP 1.69: d1rgxb_
  • Chain 'C':
    Domains in SCOP 1.69: d1rgxc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rgxA (A:)
    mknlsfpllflfflvpellgssmplcpideaidkkikqdfnslfpnaikniglncwtvss
    rgklascpegtavlscscgsacgswdireekvchcqcaridwtaarccklqvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgxA (A:)
    cpideaidkkikqdfnslfpnaikniglncwtvssrgklascpegtavlscscgsacgsw
    direekvchcqcaridwtaarccklqvas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rgxB (B:)
    mknlsfpllflfflvpellgssmplcpideaidkkikqdfnslfpnaikniglncwtvss
    rgklascpegtavlscscgsacgswdireekvchcqcaridwtaarccklqvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgxB (B:)
    cpideaidkkikqdfnslfpnaikniglncwtvssrgklascpegtavlscscgsacgsw
    direekvchcqcaridwtaarccklqvas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rgxC (C:)
    mknlsfpllflfflvpellgssmplcpideaidkkikqdfnslfpnaikniglncwtvss
    rgklascpegtavlscscgsacgswdireekvchcqcaridwtaarccklqvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgxC (C:)
    ssmplcpideaidkkikqdfnslfpnaikniglncwtvssrgklascpegtavlscscgs
    acgswdireekvchcqcaridwtaarccklqvas