PDB entry 1rgv

View 1rgv on RCSB PDB site
Description: Crystal Structure of the Ferredoxin from Thauera aromatica
Deposited on 2003-11-13, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.197
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1rgva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rgvA (A:)
  alyinddctacdacveecpneaitpgdpiyvidptkcsecvgafdepqcrlvcpadcipd
  npdyretreelqekydrlhg