PDB entry 1rgs

View 1rgs on RCSB PDB site
Description: regulatory subunit of camp dependent protein kinase
Class: kinase
Keywords: regulatory subunit, kinase
Deposited on 1995-06-21, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp dependent protein kinase
    Species: Bos taurus [TaxId:9913]
    Gene: BOVINE SKELETON MUSCLE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rgsa1, d1rgsa2
  • Heterogens: CMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rgsA (A:)
    rrrrgaisaevyteedaasyvrkvipkdyktmaalakaieknvlfshlddnersdifdam
    fpvsfiagetviqqgdegdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraa
    tvkaktnvklwgidrdsyrrilmgstlrkrkmyeeflskvsilesldkwerltvadalep
    vqfedgqkivvqgepgdeffiilegsaavlqrrseneefvevgrlgpsdyfgeiallmnr
    praatvvargplkcvkldrprfervlgpcsdilkrniqqynsfvslsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgsA (A:)
    rkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgdegdnf
    yvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrdsyrri
    lmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffi
    ilegsaavlqrrseneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkldrpr
    fervlgpcsdilkrniqqynsfvs