PDB entry 1rgq

View 1rgq on RCSB PDB site
Description: M9A HCV Protease complex with pentapeptide keto-amide inhibitor
Class: Viral protein, hydrolase
Keywords: Hepatitis C virus Protease Keto amide peptide inhibitor, Viral protein, hydrolase
Deposited on 2003-11-12, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.279
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958 (Start-191)
      • conflict (174)
    Domains in SCOPe 2.08: d1rgq.1
  • Chain 'B':
    Compound: NS3 protease
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958 (11-191)
      • expression tag (8-10)
      • conflict (174)
      • expression tag (192-193)
    Domains in SCOPe 2.08: d1rgq.2
  • Chain 'C':
    Compound: ns4a peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rgq.2
  • Chain 'D':
    Compound: ns4a peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rgq.1
  • Heterogens: ZN, AKP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rgqA (A:)
    masmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcin
    gvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtr
    hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdf
    ipvenlettmrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgqA (A:)
    qvegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpa
    pqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpa
    ghavglfraavctrgvtkavdfipvenlettmrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rgqB (B:)
    masmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcin
    gvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtr
    hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdf
    ipvenlettmrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgqB (B:)
    qmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyh
    gagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvr
    rrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdfipvenlet
    tmrsgs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgqC (C:)
    kgsvvivgrivlsgkpaiipkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rgqD (D:)
    kgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgqD (D:)
    gsvvivgrivlsgkpai