PDB entry 1rgp

View 1rgp on RCSB PDB site
Description: gtpase-activation domain from rhogap
Class: g-protein
Keywords: g-protein, gap, signal-transduction
Deposited on 1996-12-05, released 1997-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhogap
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rgpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rgpA (A:)
    hvkleqlgiprqvlkyddflkstqkspatapkpmpprpplpnqqfgvslqhlqeknpeqe
    pipivlretvaylqahalttegifrrsantqvvrevqqkynmglpvdfdqynelhlpavi
    lktflrelpeplltfdlyphvvgflnidesqrvpatlqvlqtlpeenyqvlrfltaflvq
    isahsdqnkmtntnlavvfgpnllwakdaaitlkainpintftkflldhqgelfpspdps
    gl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgpA (A:)
    prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
    vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
    tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwinpintftkf
    lldhqgelf