PDB entry 1rgo

View 1rgo on RCSB PDB site
Description: Structural Basis for Recognition of the mRNA Class II AU-Rich Element by the Tandem Zinc Finger Domain of TIS11d
Class: RNA binding protein
Keywords: TIS11 TTP tristetraprolin butyrate response factor ERF Nup475 ZFP Zn zinc finger RNA ss single-stranded ARE UTR tandem intercalation intercalate specific, RNA BINDING PROTEIN
Deposited on 2003-11-12, released 2004-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrate response factor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ZFP36L2, BRF2, TIS11D, ERF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rgoa1, d1rgoa2
  • Chain 'D':
    Compound: RNA (5'-r(*up*up*ap*up*up*up*ap*up*u)-3')
    Species: synthetic, synthetic
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rgoA (A:)
stryktelcrpfeesgtckygekcqfahgfhelrsltrhpkyktelcrtfhtigfcpygp
rchfihnade

  • Chain 'D':
    No sequence available.