PDB entry 1rge

View 1rge on RCSB PDB site
Description: hydrolase, guanyloribonuclease
Class: hydrolase (guanyloribonuclease)
Keywords: hydrolase (guanyloribonuclease)
Deposited on 1995-06-05, released 1996-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 1996-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.109
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rgea_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rgeb_
  • Heterogens: SO4, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgeA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgeB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidqtc