PDB entry 1rge

View 1rge on RCSB PDB site
Description: hydrolase, guanyloribonuclease
Class: hydrolase (guanyloribonuclease)
Keywords: hydrolase (guanyloribonuclease)
Deposited on 1995-06-05, released 1996-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease
  Species: Streptomyces aureofaciens [TaxId:1894]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
  Domains in SCOPe 2.08: d1rgea_
• Chain 'B':
  Compound: Ribonuclease
  Species: Streptomyces aureofaciens [TaxId:1894]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
  Domains in SCOPe 2.08: d1rgeb_
• Heterogens: SO4, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rgeA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeatqedyytgdhyatfslidqtc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rgeB (B:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeatqedyytgdhyatfslidqtc