PDB entry 1rgd

View 1rgd on RCSB PDB site
Description: structure refinement of the glucocorticoid receptor-dna binding domain from nmr data by relaxation matrix calculations
Deposited on 1995-01-06, released 1995-02-14
The last revision prior to the SCOP 1.59 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1rgd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rgd_ (-)
  clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
  clqagmnlear