PDB entry 1rgb

View 1rgb on RCSB PDB site
Description: Phospholipase A2 from Vipera ammodytes meridionalis
Class: hydrolase
Keywords: Phospholipase A2, Neurotoxin, Elaidoylamide, HYDROLASE
Deposited on 2003-11-12, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.234
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Vipera ammodytes meridionalis [TaxId:73841]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rgba1
  • Chain 'B':
    Compound: phospholipase a2
    Species: Vipera ammodytes meridionalis [TaxId:73841]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rgbb1
  • Chain 'K':
    Compound: phospholipase a2
    Species: Vipera ammodytes meridionalis [TaxId:73841]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rgbk1
  • Chain 'L':
    Compound: phospholipase a2
    Species: Vipera ammodytes meridionalis [TaxId:73841]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rgbl1
  • Heterogens: ELD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgbA (A:)
    nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
    laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
    qc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgbB (B:)
    nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
    laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
    qc
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgbK (K:)
    nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
    laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
    qc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgbL (L:)
    nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
    laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
    qc