PDB entry 1rg6

View 1rg6 on RCSB PDB site
Description: Solution structure of the C-terminal domain of p63
Class: gene regulation
Keywords: p73 sam-like domain, gene regulation
Deposited on 2003-11-11, released 2004-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: second splice variant p63
    Species: Homo sapiens [TaxId:9606]
    Gene: p63
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1rg6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rg6A (A:)
    pppyptdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwk
    gildhrqlhefaaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rg6A (A:)
    ptdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkgild
    hrqlhef