PDB entry 1rg0

View 1rg0 on RCSB PDB site
Description: Monoclinic crystal form of the truncated K122-4 pilin from Pseudomonas aeruginosa
Class: cell adhesion
Keywords: Type IV Pilin, Lectin, Adhesin, Pseudomonas
Deposited on 2003-11-10, released 2004-09-07
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.237
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fimbrial protein
  Species: Pseudomonas aeruginosa
  Gene: PILA, FIMA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17838 (4-125)
    • cloning artifact (0-3)
    • see remark 999 (11)
  Domains in SCOP 1.75: d1rg0a_
• Chain 'B':
  Compound: fimbrial protein
  Species: Pseudomonas aeruginosa
  Gene: PILA, FIMA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17838 (4-125)
    • cloning artifact (0-3)
    • see remark 999 (11)
  Domains in SCOP 1.75: d1rg0b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rg0A (A:)
  isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
  gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
  attttp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rg0B (B:)
  isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
  gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
  attttp