PDB entry 1rfz

View 1rfz on RCSB PDB site
Description: Structure of Protein of Unknown Function from Bacillus stearothermophilus
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, Hypothetical Protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2003-11-10, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein APC35681
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rfza_
  • Chain 'B':
    Compound: Hypothetical protein APC35681
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rfzb_
  • Chain 'C':
    Compound: Hypothetical protein APC35681
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rfzc_
  • Chain 'D':
    Compound: Hypothetical protein APC35681
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rfzd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rfzA (A:)
    snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
    revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
    yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahraanae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfzA (A:)
    snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
    revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
    yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rfzB (B:)
    snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
    revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
    yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahraanae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfzB (B:)
    snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
    revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
    yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rfzC (C:)
    snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
    revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
    yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahraanae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfzC (C:)
    sefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrviskrevq
    nailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnygyidk
    qkpgilqylndkstgkcntflddivgaiaaaassrlahraa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rfzD (D:)
    snamsefimnnleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrvisk
    revqnailtgiqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnyg
    yidkqkpgilqylndkstgkcntflddivgaiaaaassrlahraanae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfzD (D:)
    nleqtarrwleergvtvekiaelvyylqskyhpdltmeecienvnrviskrevqnailtg
    iqldklaedgrldeplqsiirrdeglygvdeilalsivnvygsigftnygyidkqkpgil
    qylndkstgkcntflddivgaiaaaassrlahra