PDB entry 1rfy

View 1rfy on RCSB PDB site
Description: Crystal Structure of Quorum-Sensing Antiactivator TraM
Class: transcription
Keywords: inter- and intra-molcular two-helix coiled coil; homodimer, TRANSCRIPTION
Deposited on 2003-11-10, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional repressor tram
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: traM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57471
      • conflict (89)
    Domains in SCOPe 2.07: d1rfya_
  • Chain 'B':
    Compound: transcriptional repressor tram
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: traM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57471
      • conflict (89)
    Domains in SCOPe 2.07: d1rfyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rfyA (A:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlisilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfyA (A:)
    kkvelrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqh
    iryieasiemhaqmsalntlisilgfipk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rfyB (B:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlisilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfyB (B:)
    velrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqhir
    yieasiemhaqmsalntlisilgfipkv