PDB entry 1rfy

View 1rfy on RCSB PDB site
Description: crystal structure of quorum-sensing antiactivator tram
Deposited on 2003-11-10, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rfya_
  • Chain 'B':
    Domains in SCOP 1.71: d1rfyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rfyA (A:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlisilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfyA (A:)
    kkvelrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqh
    iryieasiemhaqmsalntlisilgfipk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rfyB (B:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlisilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfyB (B:)
    velrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqhir
    yieasiemhaqmsalntlisilgfipkv