PDB entry 1rfw

View 1rfw on RCSB PDB site
Description: Role of hydrogen bonding in the active site of human manganese superoxide dismutase
Class: oxidoreductase
Keywords: mnsod manganese superoxide dismutase
Deposited on 2003-11-10, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-04-27, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.249
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: HOMO SAPIENS
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
      • engineered (122)
    Domains in SCOPe 2.07: d1rfwa1, d1rfwa2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: HOMO SAPIENS
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
      • engineered (122)
    Domains in SCOPe 2.07: d1rfwb1, d1rfwb2
  • Heterogens: MW1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rfwA (A:)
    khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgfgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rfwB (B:)
    khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgfgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk