PDB entry 1rfj

View 1rfj on RCSB PDB site
Description: crystal structure of potato calmodulin pcm6
Deposited on 2003-11-10, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rfja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rfjA (A:)
    madqltedqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpeflnlmarkmkdtdseeelkeafrvfdkdqngfisaaelrhvmtnlgekltde
    evdemireadvdgdgqinydefvkvmmak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfjA (A:)
    madqltedqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpeflnlmarkmkdtdseeelkeafrvfdkdqngfisaaelrhvmtnlgekltde
    evdemireadvdgdgqinydefvkvmma