PDB entry 1rfg

View 1rfg on RCSB PDB site
Description: Crystal Structure of Human Purine Nucleoside Phosphorylase Complexed with Guanosine
Class: transferase
Keywords: purine nucleoside phosphorylase, drug design, synchrotron, guanosine, transferase
Deposited on 2003-11-09, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: NP, PNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rfge_
  • Heterogens: SO4, GMP, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rfgE (E:)
engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas