PDB entry 1rfg

View 1rfg on RCSB PDB site
Description: Crystal Structure of Human Purine Nucleoside Phosphorylase Complexed with Guanosine
Class: transferase
Keywords: purine nucleoside phosphorylase, drug design, crystallography, synchrotron, guanosine
Deposited on 2003-11-09, released 2004-12-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: HOMO SAPIENS
    Gene: NP, PNP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rfge_
  • Heterogens: SO4, GMP, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rfgE (E:)
    engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
    pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
    pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
    geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas