PDB entry 1rf8

View 1rf8 on RCSB PDB site
Description: Solution structure of the yeast translation initiation factor eIF4E in complex with m7GDP and eIF4GI residues 393 to 490
Class: biosynthetic protein, translation
Keywords: Initiation factor, Protein biosynthesis, Translation regulation, BIOSYNTHETIC PROTEIN, TRANSLATION
Deposited on 2003-11-07, released 2003-12-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TIF45, CDC33, YOL139C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07260 (0-212)
      • conflict (119)
      • conflict (131)
      • conflict (168)
      • conflict (199)
    Domains in SCOPe 2.01: d1rf8a_
  • Chain 'B':
    Compound: Eukaryotic initiation factor 4F subunit p150
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TIF4631, YGR162W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39935 (0-99)
      • cloning artifact (0-1)
    Domains in SCOPe 2.01: d1rf8b_
  • Heterogens: MTN, M7G

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf8A (A:)
msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlc
gkgadidelwlctllavigetideddsqingvvlsirkggnkfalwtkcedkepllrigg
kfkqvlkltddghleffphcsangrhpqpsitl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf8B (B:)
gsigleaeietttdetddgtntvshilnvlkdatpiedvfsfnypegiegpdikykkehv
kytygptfllqfkdklnvkadaewvqstaskivippgmgr