PDB entry 1rf7

View 1rf7 on RCSB PDB site
Description: structure of dihydrofolate reductase complexed with dihydrofolate
Deposited on 1996-10-24, released 1997-03-12
The last revision prior to the SCOP 1.61 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1rf7__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf7_ (-)
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr