PDB entry 1rf3

View 1rf3 on RCSB PDB site
Description: Structurally Distinct Recognition Motifs in Lymphotoxin-B Receptor and CD40 for TRAF-mediated Signaling
Class: signaling protein
Keywords: CD40, NF-KB signaling, LTBR, TNF receptor, TRAF3 crystallography, SIGNALING PROTEIN
Deposited on 2003-11-07, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tnf receptor associated factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TRAF3 OR CRAF1 OR CAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rf3a1, d1rf3a2
  • Chain 'B':
    Compound: 24-residue peptide from Lymphotoxin-B Receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rf3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rf3A (A:)
    ntgllesqlsrhdqmlsvhdirladmdlrfqvletasyngvliwkirdykrrkqeavmgk
    tlslysqpfytgyfgykmcarvylngdgmgkgthlslffvimrgeydallpwpfkqkvtl
    mlmdqgssrrhlgdafkpdpnsssfkkptgemniasgcpvfvaqtvlengtyikddtifi
    kvivdtsdlpdplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rf3A (A:)
    ntgllesqlsrhdqmlsvhdirladmdlrfqvletasyngvliwkirdykrrkqeavmgk
    tlslysqpfytgyfgykmcarvylngdgmgkgthlslffvimrgeydallpwpfkqkvtl
    mlmdqgssrrhlgdafkpdpnsssfkkptgemniasgcpvfvaqtvlengtyikddtifi
    kvivdtsdlpdp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rf3B (B:)
    pypipeegdpgppglstphqedgk