PDB entry 1rf2

View 1rf2 on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV4
Class: toxin
Keywords: Bivalent, Cholera, Toxin, Pentamer, Complex
Deposited on 2003-11-07, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.134
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rf2d_
  • Chain 'E':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rf2e_
  • Chain 'F':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rf2f_
  • Chain 'G':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rf2g_
  • Chain 'H':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rf2h_
  • Heterogens: BV4, TRS, PGE, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf2D (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf2E (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf2F (F:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf2G (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rf2H (H:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman