PDB entry 1ret

View 1ret on RCSB PDB site
Description: determination of the structure of the DNA binding domain of gamma delta resolvase in solution
Class: site-specific recombinase
Keywords: site-specific recombinase
Deposited on 1994-06-29, released 1994-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma delta-resolvase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1reta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1retA (A:)
    grkrkidrdavlnmwqqglgashisktmniarstvykvinesn