PDB entry 1reo

View 1reo on RCSB PDB site
Description: l-amino acid oxidase from agkistrodon halys pallas
Deposited on 2003-11-07, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1reoA (A:)
    andrnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvt
    vleaseraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnaw
    yfiknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnky
    dtystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggm
    dklptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratr
    rikfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnh
    nftsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkw
    sldkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardv
    nraseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1reoA (A:)
    drnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvtvl
    easeraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnawyf
    iknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnkydt
    ystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggmdk
    lptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratrri
    kfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnf
    tsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsl
    dkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardvnr
    aseq