PDB entry 1rei
View 1rei on RCSB PDB site
Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution
Class: immunoglobulin(part)sequesters antigens
Keywords: immunoglobulin(part)sequesters antigens
Deposited on
1976-03-17, released
1976-05-19
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: bence-jones protein rei (light chain)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1reia_ - Chain 'B':
Compound: bence-jones protein rei (light chain)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1reib_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1reiA (A:)
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1reiB (B:)
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit