PDB entry 1reg

View 1reg on RCSB PDB site
Description: crystal structure of the t4 rega translational regulator protein at 1.9 angstroms resolution
Deposited on 1995-01-11, released 1996-01-01
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-01, with a file datestamp of 1996-01-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.57: d1regx_
  • Chain 'Y':
    Domains in SCOP 1.57: d1regy_

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1regX (X:)
    mieitlkkpedflkvketltrmgiannkdkvlyqschilqkkglyyivhfkemlrmdgrq
    vemteedevrrdsiawlledwglieivpgqrtfmkdltnnfrvisfkqkhewklvpkyti
    gn
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1regY (Y:)
    mieitlkkpedflkvketltrmgiannkdkvlyqschilqkkglyyivhfkemlrmdgrq
    vemteedevrrdsiawlledwglieivpgqrtfmkdltnnfrvisfkqkhewklvpkyti