PDB entry 1rec

View 1rec on RCSB PDB site
Description: three-dimensional structure of recoverin, a calcium sensor in vision
Deposited on 1993-10-29, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1rec__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1rec_ (-)
    lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
    vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
    ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
    epqkvkeklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rec_ (-)
    lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
    vfrsfgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivtaifkmi
    spedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqfepqkv
    keklk